Bchips

Chemotaxis Inhibitory Protein of Staphylococcus aureus (CHIPS)

CHIPS was identified by Karen Ellen Veltkamp and Carla de Haas in 2004. CHIPS binds two chemoattractant receptors, the receptor for complement C5a (C5aR1 or CD88) and the receptor for formylated peptides (FPR1). Binding to the receptors blocks ligand (C5a and fMLF respectively) induced activation including migration.

 

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

 

References:

1) Chemotaxis Inhibitory Protein of Staphylococcus aureus, a Bacterial Antiinflammatory Agent.

2) Chemotaxis inhibitory protein of Staphylococcus aureus binds specifically to the C5a and formylated peptide receptor.

3) The structure of the C5a receptor-blocking domain of chemotaxis inhibitory protein of Staphylococcus aureus is related to a group of immune evasive molecules.