Extracellular Complement binding protein (Ecb)
Ecb was identified by Ilse Jongerius in 2007. Ecb is homologues to the C-terminal part of Efb that binds complement C3. The complement inhibition is due to blocking C3b-containing convertases: the alternative pathway C3 convertase and the C5 convertases.
QTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
References:
1) Staphylococcal complement evasion by various convertase-blocking molecules.
2) Convertase inhibitory properties of Staphylococcal extracellular complement-binding protein.