Staphylococcal Superantigen-Like 10 (SSL10)
SSL10 binding to CXCR4 was identified by Annemiek Walenkamp in 2009. As a consequence, SSL10 inhibits the CXCL12-induced migration of human tumor cells such as the leukemia cell line Jurkat and the cervical carcinoma cell line HeLa. Initially SSL10 was shown to specifically bind to the human IgG1 Fc domain therby blocking FcR activities. In addition, SSL10 binds to fibrinogen and fibronectin from plasma, and inhibits blood coagulation by interfering with activation via binding to the Gla domain of coagulation factor. Crystal structure is not yet resolved.
KQNQKSVNKHDKEALYRYYTGKTMEMKNISALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQEKRDKHDIFYTVGGVIQNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKELDYKLRKHLIEKYGLYKTISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDIEVNLK
References:
1) Staphylococcal superantigen-like 10 inhibits CXCL12-induced human tumor cell migration.
2) Specificity of staphylococcal superantigen-like protein 10 toward the human IgG1 Fc domain.
