Staphopain A or sspP or ScpA
The specific cleavage of the N-terminus of CXCR2 (interleukin-8 Receptor-B or CD182) by the cysteine protease Staphopain was discovered by Alex Laarman in 2012. Cleavage of CXCR2 renders neutrophils unresponsive to all specific ligands, including migration. Staphopain A exists as a pro-peptide and is inhibited by the staphylococcal inhibitor staphopain B (ScpB).
MKRNFPKLIALSLIFSLSITPIANAESNSNIKAKDKRHVQVNVEDKSVPTDVRNLAQKDYLSYVTSLDKIYNKEKASYTLGEPFKIYKFNKKSDGNYYFPVLNTEGNIDYIVTISPKVTKDSSSSSKYTINVSSFLSKALNEYKDQQITILTNSKGYYVVTQNHKAKLVLKTPRLEDKKAKKTESIPTGNNVTQLKQKASVTMPTSQFKSNNYTYNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
Note: Full unprocessed sequence
References:
Staphylococcus aureus Staphopain A inhibits CXCR2-dependent neutrophil activation and chemotaxis.