Formyl Peptide Receptor-Like-1 Inhibitory Protein (FLIPr)
FLIPr was identified by Cris Prat in 2006. FLIPr binds to the formyl peptide receptor family members FPR2 (formally annotated as formyl peptide receptor-like-1 or FPRL1) and weakly to the FPR1. Binding to the receptors blocks ligand (MMK-1 peptide and fMLF respectively) induced activation including migration. FLIPr has a homologue called FLIPr-like.
FFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSIYWD
References:
1) A new staphylococcal anti-inflammatory protein that antagonizes the formyl peptide receptor-like 1.
2) A homolog of formyl peptide receptor-like 1 (FPRL1) inhibitor from Staphylococcus aureus (FPRL1 inhibitory protein) that inhibits FPRL1 and FPR.
