AsbiSecond Binding Protein of Immunoglobulin (Sbi)

Sbi is a protein with dual activity; two IgG-binding domains with sequence homology to those of Spa (protein A) and two domains that bind Complement C3.

 

TQQTSTKHQTTQNNYVTDQQKAFYQVLHLKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQEKNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEANSKLPKDLRDKNNRFVEKVSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVAPKVEAPQIQSPQIEKPKVESPKVEVPQIQSPKVEVPQSKLLGYYQSLKDSFNYGYKYLTDTYKSYKEKYDTAKYYYNTYYKYKGAIDQTVLTVLGSGSKSYIQPLKVDDKNGYLAKSYAQVRNYVTESINTGKVLYTFYQNPTLVKTAIKAQETASSIKNTLSNLLSFWKK

 

References:

1) A second IgG-binding protein in Staphylococcus aureus.

2) S. aureus IgG-binding proteins SpA and Sbi: host specificity and mechanisms of immune complex formation.

3) The Sbi protein is a multifunctional immune evasion factor of Staphylococcus aureus.