SSL7

Staphylococcal Superantigen-Like 7 (SSL7)

The impact of SSL7 on staphylococcal-induced C5a-mediated effects was described by Jovanka Bestebroer in 2010. The effects on C5 binding were independent from the IgA binding properties. SSL7 also showed potent in-vivo inhibition in a murine model of immune complex peritonitis.

 

KEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQNHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEVSLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI

 

References:

1) Structural relationships and cellular tropism of staphylococcal superantigen-like proteins.

2) Functional basis for complement evasion by staphylococcal superantigen-like 7.

3) The staphylococcal superantigen-like protein 7 binds IgA and complement C5 and inhibits IgA-Fc alpha RI binding and serum killing of bacteria.